| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein Prokaryotic actin homolog MreB [64087] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [64088] (4 PDB entries) |
| Domain d1jcea2: 1jce A:141-336 [62877] |
PDB Entry: 1jce (more details), 2.1 Å
SCOPe Domain Sequences for d1jcea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}
lnveepsgnmvvdigggttevavislgsivtwesiriagdemdeaivqyvretyrvaige
rtaervkieignvfpskendelettvsgidlstglprkltlkggevrealrsvvvaives
vrttlektppelvsdiiergifltgggsllrgldtllqketgisvirseepltavakgag
mvldkvnilkklqgag
Timeline for d1jcea2: