Lineage for d1jcea2 (1jce A:141-336)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) 
Family c.55.1.1: Actin/HSP70 [53068] (4 proteins) 
Protein Prokaryotic actin homolog MreB [64087] (1 species) Species Thermotoga maritima [TaxId:243274] [64088] (3 PDB entries) 
Domain d1jcea2: 1jce A:141-336 [62877]
Details for d1jcea2
PDB Entry: 1jce (more details), 2.1 Å
PDB Description: mreb from thermotoga maritima
SCOP Domain Sequences for d1jcea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima}
lnveepsgnmvvdigggttevavislgsivtwesiriagdemdeaivqyvretyrvaige
rtaervkieignvfpskendelettvsgidlstglprkltlkggevrealrsvvvaives
vrttlektppelvsdiiergifltgggsllrgldtllqketgisvirseepltavakgag
mvldkvnilkklqgag
SCOP Domain Coordinates for d1jcea2:
Click to download the PDB-style file with coordinates for d1jcea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jcea2:
- d1jcea2 is new in SCOP 1.57
- d1jcea2 appears in SCOP 1.59
- d1jcea2 appears in the current release, SCOPe 2.08
View in 3D
