![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (64 species) not a true protein |
![]() | Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries) |
![]() | Domain d4czla1: 4czl A:9-149 [256756] automated match to d1jcea1 complexed with adp, mg |
PDB Entry: 4czl (more details), 1.6 Å
SCOPe Domain Sequences for d4czla1:
Sequence, based on SEQRES records: (download)
>d4czla1 c.55.1.0 (A:9-149) automated matches {Caulobacter vibrioides [TaxId: 155892]} isndiaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlgrtpghm eairpmrdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindscl nagarrvglidepmaaaigag
>d4czla1 c.55.1.0 (A:9-149) automated matches {Caulobacter vibrioides [TaxId: 155892]} isndiaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlmeairpm rdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindsclnagarr vglidepmaaaigag
Timeline for d4czla1: