Lineage for d4cs5a1 (4cs5 A:1-126)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927131Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1927132Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1927500Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1927501Protein automated matches [226907] (12 species)
    not a true protein
  7. 1927535Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [256684] (1 PDB entry)
  8. 1927536Domain d4cs5a1: 4cs5 A:1-126 [256687]
    automated match to d1plqa1

Details for d4cs5a1

PDB Entry: 4cs5 (more details), 3 Å

PDB Description: Crystal Structure of PCNA from Litopenaeus vannamei
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4cs5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cs5a1 d.131.1.0 (A:1-126) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mfearlvqgsllkkvleaikdllneaswdcadsgiqlqamdnshvslvslnlrakgfdky
rcdrnlimgmnltsmskilkcaanddiitmkaqdnadtvtfmfespnqekvsdyemklmn
ldqehl

SCOPe Domain Coordinates for d4cs5a1:

Click to download the PDB-style file with coordinates for d4cs5a1.
(The format of our PDB-style files is described here.)

Timeline for d4cs5a1: