Lineage for d4cs5a1 (4cs5 A:1-126)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1670188Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1670189Protein automated matches [226907] (12 species)
    not a true protein
  7. 1670223Species Litopenaeus vannamei [TaxId:6689] [256684] (1 PDB entry)
  8. 1670224Domain d4cs5a1: 4cs5 A:1-126 [256687]
    automated match to d1plqa1

Details for d4cs5a1

PDB Entry: 4cs5 (more details), 3 Å

PDB Description: Crystal Structure of PCNA from Litopenaeus vannamei
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4cs5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cs5a1 d.131.1.0 (A:1-126) automated matches {Litopenaeus vannamei [TaxId: 6689]}
mfearlvqgsllkkvleaikdllneaswdcadsgiqlqamdnshvslvslnlrakgfdky
rcdrnlimgmnltsmskilkcaanddiitmkaqdnadtvtfmfespnqekvsdyemklmn
ldqehl

SCOPe Domain Coordinates for d4cs5a1:

Click to download the PDB-style file with coordinates for d4cs5a1.
(The format of our PDB-style files is described here.)

Timeline for d4cs5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cs5a2