SCOPe 2.04: Domain d4cs5b1: 4cs5 B:1-126

Lineage for d4cs5b1 (4cs5 B:1-126)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (12 species)
   not a true protein

7. Species Litopenaeus vannamei [TaxId:6689] [256684] (1 PDB entry)

8. Domain d4cs5b1: 4cs5 B:1-126 [256685]
   automated match to d1plqa1

Details for d4cs5b1

PDB Entry: 4cs5, 3 Å

PDB Description: Crystal Structure of PCNA from Litopenaeus vannamei

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4cs5b1:

Sequence; same for both SEQRES and ATOM records:

>d4cs5b1 d.131.1.0 (B:1-126) automated matches {Litopenaeus vannamei [TaxId: 6689]}
mfearlvqgsllkkvleaikdllneaswdcadsgiqlqamdnshvslvslnlrakgfdky
rcdrnlimgmnltsmskilkcaanddiitmkaqdnadtvtfmfespnqekvsdyemklmn
ldqehl

Timeline for d4cs5b1:

• d4cs5b1 is new in SCOPe 2.04-stable
  
• d4cs5b1 appears in SCOPe 2.05
  
• d4cs5b1 appears in the current release, SCOPe 2.08