SCOPe 2.05: Domain d4cs5a2: 4cs5 A:127-255

Lineage for d4cs5a2 (4cs5 A:127-255)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (12 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [256684] (1 PDB entry)

8. Domain d4cs5a2: 4cs5 A:127-255 [256688]
   automated match to d1plqa2

Details for d4cs5a2

PDB Entry: 4cs5, 3 Å

PDB Description: Crystal Structure of PCNA from Litopenaeus vannamei

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4cs5a2:

Sequence; same for both SEQRES and ATOM records:

>d4cs5a2 d.131.1.0 (A:127-255) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
gipetdyacviklpsgefaricrdlsqfgesiviactkegvkfsaagdigtaniklaqts
svdkeeeavviemqepvtltfacrylnmftkatplspqvslsmspdvplvveyaigeigh
iryflapki

Timeline for d4cs5a2:

• d4cs5a2 first appeared in SCOPe 2.04
  
• d4cs5a2 appears in SCOPe 2.06
  
• d4cs5a2 appears in the current release, SCOPe 2.08