Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) |
Species Azotobacter vinelandii [TaxId:354] [50422] (1 PDB entry) |
Domain d1a8pa1: 1a8p A:2-100 [25654] Other proteins in same PDB: d1a8pa2 complexed with fad |
PDB Entry: 1a8p (more details), 2 Å
SCOPe Domain Sequences for d1a8pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlv
Timeline for d1a8pa1: