SCOPe 2.07: Domain d1a8pa1: 1a8p A:2-100

Lineage for d1a8pa1 (1a8p A:2-100)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Azotobacter vinelandii [TaxId:354] [50422] (1 PDB entry)

8. Domain d1a8pa1: 1a8p A:2-100 [25654]
   Other proteins in same PDB: d1a8pa2
   complexed with fad

Details for d1a8pa1

PDB Entry: 1a8p, 2 Å

PDB Description: ferredoxin reductase from azotobacter vinelandii

PDB Compounds: (A:) nadph:ferredoxin oxidoreductase

SCOPe Domain Sequences for d1a8pa1:

Sequence; same for both SEQRES and ATOM records:

>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]}
snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye
ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlv

Timeline for d1a8pa1:

• d1a8pa1 first appeared (with stable ids) in SCOP 1.55, called d1a8p_1
  
• d1a8pa1 appears in SCOPe 2.06
  
• d1a8pa1 appears in the current release, SCOPe 2.08