PDB entry 1a8p

View 1a8p on RCSB PDB site
Description: ferredoxin reductase from azotobacter vinelandii
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1998-03-28, released 1998-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph:ferredoxin oxidoreductase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a8pa1, d1a8pa2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a8pA (A:)
    msnlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspny
    eehleffsikvqngpltsrlqhlkegdelmvsrkptgtlvtsdllpgkhlymlstgtgla
    pfmsliqdpevyerfekvvlihgvrqvnelayqqfitehlpqseyfgeavkekliyyptv
    tresfhnqgrltdlmrsgklfediglppinpqddramicgspsmldescevldgfglkis
    prmgepgdylierafvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a8pA (A:)
    snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye
    ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlvtsdllpgkhlymlstgtglap
    fmsliqdpevyerfekvvlihgvrqvnelayqqfitehlpqseyfgeavkekliyyptvt
    resfhnqgrltdlmrsgklfediglppinpqddramicgspsmldescevldgfglkisp
    rmgepgdylierafvek