Lineage for d2me7a1 (2me7 A:3-33)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635463Protein automated matches [197331] (11 species)
    not a true protein
  7. 2635502Species Mesobuthus tamulus [TaxId:34647] [255376] (18 PDB entries)
  8. 2635515Domain d2me7a1: 2me7 A:3-33 [256421]
    Other proteins in same PDB: d2me7a2
    automated match to d1scya_
    mutant

Details for d2me7a1

PDB Entry: 2me7 (more details)

PDB Description: nmr solution structure of the gs-tamapin mutation r6a
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 5.4

SCOPe Domain Sequences for d2me7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2me7a1 g.3.7.2 (A:3-33) automated matches {Mesobuthus tamulus [TaxId: 34647]}
afcnlarcelscrslgllgkcigeeckcvpy

SCOPe Domain Coordinates for d2me7a1:

Click to download the PDB-style file with coordinates for d2me7a1.
(The format of our PDB-style files is described here.)

Timeline for d2me7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2me7a2