| Class g: Small proteins [56992] (94 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
| Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
| Protein automated matches [197331] (4 species) not a true protein |
| Species Mesobuthus tamulus [TaxId:34647] [255376] (7 PDB entries) |
| Domain d2me7a1: 2me7 A:3-33 [256421] Other proteins in same PDB: d2me7a2 automated match to d1scya_ mutant |
PDB Entry: 2me7 (more details)
SCOPe Domain Sequences for d2me7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2me7a1 g.3.7.2 (A:3-33) automated matches {Mesobuthus tamulus [TaxId: 34647]}
afcnlarcelscrslgllgkcigeeckcvpy
Timeline for d2me7a1: