SCOPe 2.08: Domain d2lzua2: 2lzu A:69-107

Lineage for d2lzua2 (2lzu A:69-107)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)

8. Domain d2lzua2: 2lzu A:69-107 [256406]
   automated match to d2d8ya2
   complexed with zn

Details for d2lzua2

PDB Entry: 2lzu

PDB Description: Solution structure of LIMD2

PDB Compounds: (A:) LIM domain-containing protein 2

SCOPe Domain Sequences for d2lzua2:

Sequence; same for both SEQRES and ATOM records:

>d2lzua2 g.39.1.0 (A:69-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cckhchtklslgsyaalhgefyckphfqqlfkskgnyde

Timeline for d2lzua2:

• d2lzua2 first appeared in SCOPe 2.04
  
• d2lzua2 appears in SCOPe 2.07