PDB entry 2lzu

View 2lzu on RCSB PDB site
Description: Solution structure of LIMD2
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2012-10-10, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LIM domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LIMD2, SB143
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lzua1, d2lzua2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lzuA (A:)
    raqvketcaacqktvypmerlvadklifhnscfcckhchtklslgsyaalhgefyckphf
    qqlfkskgnyde