SCOPe 2.07: Domain d1a8da2: 1a8d A:248-452

Lineage for d1a8da2 (1a8d A:248-452)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein Tetanus neurotoxin [50400] (1 species)

7. Species Clostridium tetani [TaxId:1513] [50401] (10 PDB entries)

8. Domain d1a8da2: 1a8d A:248-452 [25607]
   Other proteins in same PDB: d1a8da1
   complexed with au

Details for d1a8da2

PDB Entry: 1a8d, 1.57 Å

PDB Description: tetanus toxin c fragment

PDB Compounds: (A:) tetanus neurotoxin

SCOPe Domain Sequences for d1a8da2:

Sequence; same for both SEQRES and ATOM records:

>d1a8da2 b.42.4.2 (A:248-452) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

Timeline for d1a8da2:

• d1a8da2 first appeared (with stable ids) in SCOP 1.55, called d1a8d_2
  
• d1a8da2 appears in SCOPe 2.06
  
• d1a8da2 appears in the current release, SCOPe 2.08