Lineage for d1a8d_2 (1a8d 248-452)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins) Protein Tetanus neurotoxin [50400] (1 species) Species Clostridium tetani [50401] (6 PDB entries) 
Domain d1a8d_2: 1a8d 248-452 [25607]
Other proteins in same PDB: d1a8d_1
Details for d1a8d_2
PDB Entry: 1a8d (more details), 1.57 Å
PDB Description: tetanus toxin c fragment
SCOP Domain Sequences for d1a8d_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8d_2 b.42.4.2 (248-452) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd
SCOP Domain Coordinates for d1a8d_2:
Click to download the PDB-style file with coordinates for d1a8d_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a8d_2:
- d1a8d_2 appears in SCOP 1.57
- d1a8d_2 appears in the current release, SCOPe 2.08, called d1a8da2
View in 3D
