Lineage for d1a8da2 (1a8d A:248-452)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792493Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2792529Protein Tetanus neurotoxin [50400] (1 species)
  7. 2792530Species Clostridium tetani [TaxId:1513] [50401] (10 PDB entries)
  8. 2792531Domain d1a8da2: 1a8d A:248-452 [25607]
    Other proteins in same PDB: d1a8da1
    complexed with au

Details for d1a8da2

PDB Entry: 1a8d (more details), 1.57 Å

PDB Description: tetanus toxin c fragment
PDB Compounds: (A:) tetanus neurotoxin

SCOPe Domain Sequences for d1a8da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8da2 b.42.4.2 (A:248-452) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOPe Domain Coordinates for d1a8da2:

Click to download the PDB-style file with coordinates for d1a8da2.
(The format of our PDB-style files is described here.)

Timeline for d1a8da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8da1