Lineage for d2mllb2 (2mll B:134-255)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14495Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 14496Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 14501Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 14508Species European mistletoe (Viscum album) [TaxId:3972] [50375] (2 PDB entries)
  8. 14512Domain d2mllb2: 2mll B:134-255 [25568]
    Other proteins in same PDB: d2mlla_

Details for d2mllb2

PDB Entry: 2mll (more details), 2.7 Å

PDB Description: mistletoe lectin i from viscum album

SCOP Domain Sequences for d2mllb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mllb2 b.42.2.1 (B:134-255) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
taprevtiygfndlcmesgggsvtvetcssgkadkwalygdgsirpeqnqaqcltsggds
vagvnivscsgaasgqrwvftnegailnlknglamdvanpgggriiiypatgkpnqmwlp
vf

SCOP Domain Coordinates for d2mllb2:

Click to download the PDB-style file with coordinates for d2mllb2.
(The format of our PDB-style files is described here.)

Timeline for d2mllb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mllb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2mlla_