SCOP 1.59: Domain d1ce7b2: 1ce7 B:134-255

Lineage for d1ce7b2 (1ce7 B:134-255)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.42: beta-Trefoil [50352] (5 superfamilies)

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (2 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (2 PDB entries)

8. Domain d1ce7b2: 1ce7 B:134-255 [25566]
   Other proteins in same PDB: d1ce7a_

Details for d1ce7b2

PDB Entry: 1ce7, 2.7 Å

PDB Description: mistletoe lectin i from viscum album

SCOP Domain Sequences for d1ce7b2:

Sequence; same for both SEQRES and ATOM records:

>d1ce7b2 b.42.2.1 (B:134-255) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
taprevtiygfndlcmesgggsvtvetcssgkadkwalygdgsirpeqnqaqcltsggds
vagvnivscsgaasgqrwvftnegailnlknglamdvanpgggriiiypatgkpnqmwlp
vf

Timeline for d1ce7b2:

• d1ce7b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ce7b2 appears in SCOP 1.57
  
• d1ce7b2 appears in SCOP 1.61
  
• d1ce7b2 appears in the current release, SCOPe 2.08