Lineage for d1ce7a_ (1ce7 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139177Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 139178Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 139179Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 139221Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 139222Species European mistletoe (Viscum album) [TaxId:3972] [56382] (2 PDB entries)
  8. 139223Domain d1ce7a_: 1ce7 A: [42194]
    Other proteins in same PDB: d1ce7b1, d1ce7b2

Details for d1ce7a_

PDB Entry: 1ce7 (more details), 2.7 Å

PDB Description: mistletoe lectin i from viscum album

SCOP Domain Sequences for d1ce7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce7a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)}
yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns
ggdgitvaidvtnlyvvayqagsqsyflsgpggrhgftgttrsslpfngsypdleqyggq
rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas
flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv
c

SCOP Domain Coordinates for d1ce7a_:

Click to download the PDB-style file with coordinates for d1ce7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ce7a_: