Lineage for d1ce7b1 (1ce7 B:1-133)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111186Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 111187Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 111204Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 111211Species European mistletoe (Viscum album) [TaxId:3972] [50375] (2 PDB entries)
  8. 111212Domain d1ce7b1: 1ce7 B:1-133 [25565]
    Other proteins in same PDB: d1ce7a_

Details for d1ce7b1

PDB Entry: 1ce7 (more details), 2.7 Å

PDB Description: mistletoe lectin i from viscum album

SCOP Domain Sequences for d1ce7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce7b1 b.42.2.1 (B:1-133) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
lttygytagvyvmifdcatavgeatvwqiwgngtiinprsnlvlaassgikgttltvqtl
dytlgqgwlagnd

SCOP Domain Coordinates for d1ce7b1:

Click to download the PDB-style file with coordinates for d1ce7b1.
(The format of our PDB-style files is described here.)

Timeline for d1ce7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ce7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ce7a_