![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
![]() | Protein Acidic FGF (FGF1) [50357] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries) Uniprot P05230 16-152 ! Uniprot P05230 |
![]() | Domain d1djsb_: 1djs B: [25518] Other proteins in same PDB: d1djsa1, d1djsa2 complexed with so4 |
PDB Entry: 1djs (more details), 2.4 Å
SCOPe Domain Sequences for d1djsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djsb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]} gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy gqkailflplpvssd
Timeline for d1djsb_: