Lineage for d1djsb_ (1djs B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14402Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 14403Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (3 proteins)
  6. 14404Protein Acidic FGF (FGF1) [50357] (2 species)
  7. 14416Species Human (Homo sapiens) [TaxId:9606] [50359] (9 PDB entries)
  8. 14421Domain d1djsb_: 1djs B: [25518]
    Other proteins in same PDB: d1djsa1, d1djsa2

Details for d1djsb_

PDB Entry: 1djs (more details), 2.4 Å

PDB Description: ligand-binding portion of fibroblast growth factor receptor 2 in complex with fgf1

SCOP Domain Sequences for d1djsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djsb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens)}
gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
gqkailflplpvssd

SCOP Domain Coordinates for d1djsb_:

Click to download the PDB-style file with coordinates for d1djsb_.
(The format of our PDB-style files is described here.)

Timeline for d1djsb_: