PDB entry 1djs

View 1djs on RCSB PDB site
Description: ligand-binding portion of fibroblast growth factor receptor 2 in complex with fgf1
Class: hormone/growth factor/receptor
Keywords: fgfr, fgf, immunoglobulin, immune system, hormone-growth factor-receptor complex
Deposited on 1999-12-03, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fibroblast growth factor receptor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (5-215)
      • mutation due to splice (5)
      • modified (15)
      • modified (39)
      • modified (42)
      • modified (71)
    Domains in SCOPe 2.07: d1djsa1, d1djsa2
  • Chain 'B':
    Compound: protein (fibroblast growth factor 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (0-134)
      • modified (61)
    Domains in SCOPe 2.07: d1djsb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1djsA (A:)
    tlepegapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djsA (A:)
    tlepegapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekpylkvlkaagvnttdkeievlyirnvtfed
    ageytclagnsigisfhsawltvlpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1djsB (B:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssd