Lineage for d1ev2b_ (1ev2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791607Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2791843Protein Basic FGF (FGF2) [50355] (1 species)
  7. 2791844Species Human (Homo sapiens) [TaxId:9606] [50356] (21 PDB entries)
  8. 2791855Domain d1ev2b_: 1ev2 B: [25494]
    Other proteins in same PDB: d1ev2e1, d1ev2e2, d1ev2f1, d1ev2f2, d1ev2g1, d1ev2g2, d1ev2h1, d1ev2h2
    complexed with so4

Details for d1ev2b_

PDB Entry: 1ev2 (more details), 2.2 Å

PDB Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)
PDB Compounds: (B:) protein (fibroblast growth factor 2)

SCOPe Domain Sequences for d1ev2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev2b_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
ailflpmsak

SCOPe Domain Coordinates for d1ev2b_:

Click to download the PDB-style file with coordinates for d1ev2b_.
(The format of our PDB-style files is described here.)

Timeline for d1ev2b_: