Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein Basic FGF (FGF2) [50355] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50356] (21 PDB entries) |
Domain d1ev2b_: 1ev2 B: [25494] Other proteins in same PDB: d1ev2e1, d1ev2e2, d1ev2f1, d1ev2f2, d1ev2g1, d1ev2g2, d1ev2h1, d1ev2h2 complexed with so4 |
PDB Entry: 1ev2 (more details), 2.2 Å
SCOPe Domain Sequences for d1ev2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev2b_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]} hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk ailflpmsak
Timeline for d1ev2b_: