![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
![]() | Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries) |
![]() | Domain d1ev2e1: 1ev2 E:150-250 [21738] Other proteins in same PDB: d1ev2a_, d1ev2b_, d1ev2c_, d1ev2d_ complexed with so4 |
PDB Entry: 1ev2 (more details), 2.2 Å
SCOPe Domain Sequences for d1ev2e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev2e1 b.1.1.4 (E:150-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
Timeline for d1ev2e1: