SCOPe 2.08: Domain d1ev2h2: 1ev2 H:251-363

Lineage for d1ev2h2 (1ev2 H:251-363)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)

8. Domain d1ev2h2: 1ev2 H:251-363 [21745]
   Other proteins in same PDB: d1ev2a_, d1ev2b_, d1ev2c_, d1ev2d_
   complexed with so4

Details for d1ev2h2

PDB Entry: 1ev2, 2.2 Å

PDB Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)

PDB Compounds: (H:) protein (fibroblast growth factor receptor 2)

SCOPe Domain Sequences for d1ev2h2:

Sequence, based on SEQRES records:

>d1ev2h2 b.1.1.4 (H:251-363) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlpap

Sequence, based on observed residues (ATOM records):

>d1ev2h2 b.1.1.4 (H:251-363) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdk
eievlyirnvtfedageytclagnsigisfhsawltvlpap

Timeline for d1ev2h2:

• d1ev2h2 first appeared (with stable ids) in SCOP 1.55
  
• d1ev2h2 appears in SCOPe 2.07