SCOP 1.59: Domain d1ipwb_: 1ipw B:

Lineage for d1ipwb_ (1ipw B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)

6. Protein Inorganic pyrophosphatase [50326] (4 species)

7. Species Escherichia coli [TaxId:562] [50329] (13 PDB entries)

8. Domain d1ipwb_: 1ipw B: [25428]

Details for d1ipwb_

PDB Entry: 1ipw, 2.3 Å

PDB Description: inorganic pyrophosphatase from escherichia coli with three magnesium ions

SCOP Domain Sequences for d1ipwb_:

Sequence; same for both SEQRES and ATOM records:

>d1ipwb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Escherichia coli}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak

Timeline for d1ipwb_:

• d1ipwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ipwb_ appears in SCOP 1.57
  
• d1ipwb_ appears in SCOP 1.61
  
• d1ipwb_ appears in the current release, SCOPe 2.08