Lineage for d1ipwb_ (1ipw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790736Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2790776Species Escherichia coli [TaxId:562] [50329] (19 PDB entries)
  8. 2790794Domain d1ipwb_: 1ipw B: [25428]
    complexed with mg

Details for d1ipwb_

PDB Entry: 1ipw (more details), 2.3 Å

PDB Description: inorganic pyrophosphatase from escherichia coli with three magnesium ions
PDB Compounds: (B:) soluble inorganic pyrophosphatase

SCOPe Domain Sequences for d1ipwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipwb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak

SCOPe Domain Coordinates for d1ipwb_:

Click to download the PDB-style file with coordinates for d1ipwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ipwb_: