Lineage for d1ipwb_ (1ipw B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) 
Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein) Protein Inorganic pyrophosphatase [50326] (4 species) 
Species Escherichia coli [TaxId:562] [50329] (11 PDB entries) 
Domain d1ipwb_: 1ipw B: [25428]
Details for d1ipwb_
PDB Entry: 1ipw (more details), 2.3 Å
PDB Description: inorganic pyrophosphatase from escherichia coli with three magnesium ions
SCOP Domain Sequences for d1ipwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ipwb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Escherichia coli}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak
SCOP Domain Coordinates for d1ipwb_:
Click to download the PDB-style file with coordinates for d1ipwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ipwb_:
- d1ipwb_ appears in SCOP 1.57
- d1ipwb_ appears in the current release, SCOPe 2.08
View in 3D
