Lineage for d4ny0d3 (4ny0 D:254-362)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803903Domain d4ny0d3: 4ny0 D:254-362 [254039]
    Other proteins in same PDB: d4ny0a1, d4ny0a2, d4ny0b1, d4ny0b2, d4ny0d1, d4ny0d2
    automated match to d2al6a2

Details for d4ny0d3

PDB Entry: 4ny0 (more details), 2.8 Å

PDB Description: Crystal structure of FERM domain of human focal adhesion kinase
PDB Compounds: (D:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4ny0d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ny0d3 b.55.1.0 (D:254-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkecfkcalgsswiisvelaigpeegisyltdkgcnpthladftqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngtsqsfiirp

SCOPe Domain Coordinates for d4ny0d3:

Click to download the PDB-style file with coordinates for d4ny0d3.
(The format of our PDB-style files is described here.)

Timeline for d4ny0d3: