Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d4ny0a3: 4ny0 A:254-362 [254033] Other proteins in same PDB: d4ny0a1, d4ny0a2, d4ny0b1, d4ny0b2, d4ny0d1, d4ny0d2 automated match to d2al6a2 |
PDB Entry: 4ny0 (more details), 2.8 Å
SCOPe Domain Sequences for d4ny0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ny0a3 b.55.1.0 (A:254-362) automated matches {Human (Homo sapiens) [TaxId: 9606]} dkecfkcalgsswiisvelaigpeegisyltdkgcnpthladftqvqtiqysnsedkdrk gmlqlkiagapepltvtapsltiaenmadlidgycrlvngtsqsfiirp
Timeline for d4ny0a3: