PDB entry 4ny0

View 4ny0 on RCSB PDB site
Description: Crystal structure of FERM domain of human focal adhesion kinase
Class: transferase
Keywords: FERM domain, focal adhesion kinase, focal targeting domain, integrin signaling, TRANSFERASE
Deposited on 2013-12-10, released 2014-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.195
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05397
      • engineered mutation (55)
      • engineered mutation (151)
    Domains in SCOPe 2.07: d4ny0a1, d4ny0a2, d4ny0a3
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05397
      • engineered mutation (55)
      • engineered mutation (151)
    Domains in SCOPe 2.07: d4ny0b1, d4ny0b2, d4ny0b3
  • Chain 'C':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05397 (Start-375)
      • engineered mutation (55)
      • engineered mutation (151)
  • Chain 'D':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05397
      • engineered mutation (55)
      • engineered mutation (151)
    Domains in SCOPe 2.07: d4ny0d1, d4ny0d2, d4ny0d3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ny0A (A:)
    mgamervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlsh
    lrseevhwlhvdmgvssvrekyelahppeewkyelrirylpkgflnqftedkptlnffyq
    qvksdymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglkrffpk
    slldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiis
    velaigpeegisyltdkgcnpthladftqvqtiqysnsedkdrkgmlqlkiagapepltv
    tapsltiaenmadlidgycrlvngtsqsfiirpqkegeralpsipklansekqgmrthav
    svsetddyaeiideed
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ny0A (A:)
    ervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlshlrse
    evhwlhvdmgvssvrekyelahppeewkyelrirylpkgflnqftedkptlnffyqqvks
    dymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglkrffpkslld
    svkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisvela
    igpeegisyltdkgcnpthladftqvqtiqysnsedkdrkgmlqlkiagapepltvtaps
    ltiaenmadlidgycrlvngtsqsfiirp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ny0B (B:)
    mgamervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlsh
    lrseevhwlhvdmgvssvrekyelahppeewkyelrirylpkgflnqftedkptlnffyq
    qvksdymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglkrffpk
    slldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiis
    velaigpeegisyltdkgcnpthladftqvqtiqysnsedkdrkgmlqlkiagapepltv
    tapsltiaenmadlidgycrlvngtsqsfiirpqkegeralpsipklansekqgmrthav
    svsetddyaeiideed
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ny0B (B:)
    ervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlshlrse
    evhwlhvdmgvssvrekyelahppeewkyelrirylpkgflnqftedkptlnffyqqvks
    dymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglkrffpkslld
    svkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisvela
    igpeegisyltdkgcnpthladftqvqtiqysnsedkdrkgmlqlkiagapepltvtaps
    ltiaenmadlidgycrlvngtsqsfiirp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ny0D (D:)
    mgamervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlsh
    lrseevhwlhvdmgvssvrekyelahppeewkyelrirylpkgflnqftedkptlnffyq
    qvksdymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglkrffpk
    slldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiis
    velaigpeegisyltdkgcnpthladftqvqtiqysnsedkdrkgmlqlkiagapepltv
    tapsltiaenmadlidgycrlvngtsqsfiirpqkegeralpsipklansekqgmrthav
    svsetddyaeiideed
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ny0D (D:)
    ervlkvfhyfesnsepttwasiirhgdatdvrgiiqkivdshkvkhvacyglrlshlrse
    evhwlhvdmgvssvrekyelahppeewkyelrirylpkgflnqftedkptlnffyqqvks
    dymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglkrffpkslld
    svkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisvela
    igpeegisyltdkgcnpthladftqvqtiqysnsedkdrkgmlqlkiagapepltvtaps
    ltiaenmadlidgycrlvngtsqsfiirp