SCOPe 2.08: Domain d4nwlb1: 4nwl B:-10-182

Lineage for d4nwlb1 (4nwl B:-10-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (22 PDB entries)

8. Domain d4nwlb1: 4nwl B:-10-182 [254030]
   Other proteins in same PDB: d4nwla2, d4nwlb2
   automated match to d4nwka_
   complexed with 2r9, zn

Details for d4nwlb1

PDB Entry: 4nwl, 2.2 Å

PDB Description: crystal structure of hepatis c virus protease (ns3) complexed with bms-650032 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-4-((7- chloro-4-methoxy-1-isoquinolinyl)o xy)-n-((1r,2s)-1- ((cyclopropylsulfonyl)carbamoyl)-2-vinylc yclopropyl)-l-prolinamide

PDB Compounds: (B:) HCV NS3 1a Protease

SCOPe Domain Sequences for d4nwlb1:

Sequence; same for both SEQRES and ATOM records:

>d4nwlb1 b.47.1.3 (B:-10-182) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
gsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsin
gvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtr
hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavctrgvakavdf
ipveslettmrsp

Timeline for d4nwlb1:

• d4nwlb1 first appeared in SCOPe 2.04, called d4nwlb_
  
• d4nwlb1 appears in SCOPe 2.07