| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
| Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
| Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries) Uniprot P06746 |
| Domain d4nm1a1: 4nm1 A:10-91 [253979] Other proteins in same PDB: d4nm1a2, d4nm1a3 automated match to d1tv9a1 protein/DNA complex; complexed with mg, na, po4 |
PDB Entry: 4nm1 (more details), 2.42 Å
SCOPe Domain Sequences for d4nm1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nm1a1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd
Timeline for d4nm1a1: