Lineage for d4nm1a3 (4nm1 A:149-335)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3006901Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 3006902Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 3006903Species Human (Homo sapiens) [TaxId:9606] [81574] (145 PDB entries)
    Uniprot P06746
  8. 3006950Domain d4nm1a3: 4nm1 A:149-335 [253981]
    Other proteins in same PDB: d4nm1a1, d4nm1a2
    automated match to d4klia3
    protein/DNA complex; complexed with mg, na, po4

Details for d4nm1a3

PDB Entry: 4nm1 (more details), 2.42 Å

PDB Description: Structure of human DNA polymerase beta complexed with a nicked DNA containing a 8BrG-C at N-1 position and G-C at N position
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d4nm1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nm1a3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d4nm1a3:

Click to download the PDB-style file with coordinates for d4nm1a3.
(The format of our PDB-style files is described here.)

Timeline for d4nm1a3: