Lineage for d4n5ya1 (4n5y A:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040672Domain d4n5ya1: 4n5y A:11-324 [253881]
    Other proteins in same PDB: d4n5ya2, d4n5yb1, d4n5yb2, d4n5yc2, d4n5yd1, d4n5yd2, d4n5ye2, d4n5yf1, d4n5yf2, d4n5yg2, d4n5yh1, d4n5yh2, d4n5yi2, d4n5yj1, d4n5yj2, d4n5yk2, d4n5yl1, d4n5yl2, d4n5ym2, d4n5yn1, d4n5yn2, d4n5yo2, d4n5yp1, d4n5yp2, d4n5yq2, d4n5yr1, d4n5yr2, d4n5ys2, d4n5yt1, d4n5yt2, d4n5yu2, d4n5yv1, d4n5yv2, d4n5yw2, d4n5yx1, d4n5yx2, d4n5yy2, d4n5yz1, d4n5yz2
    automated match to d3gbna_
    complexed with nag; mutant

Details for d4n5ya1

PDB Entry: 4n5y (more details), 3.16 Å

PDB Description: Crystal structure of H5 hemagglutinin mutant (N158D, N224K and Q226L) from the influenza virus A/Viet Nam/1203/2004 (H5N1)
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4n5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5ya1 b.19.1.2 (A:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4n5ya1:

Click to download the PDB-style file with coordinates for d4n5ya1.
(The format of our PDB-style files is described here.)

Timeline for d4n5ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n5ya2
View in 3D
Domains from other chains:
(mouse over for more information)
d4n5yb1, d4n5yb2, d4n5yc1, d4n5yc2, d4n5yd1, d4n5yd2, d4n5ye1, d4n5ye2, d4n5yf1, d4n5yf2, d4n5yg1, d4n5yg2, d4n5yh1, d4n5yh2, d4n5yi1, d4n5yi2, d4n5yj1, d4n5yj2, d4n5yk1, d4n5yk2, d4n5yl1, d4n5yl2, d4n5ym1, d4n5ym2, d4n5yn1, d4n5yn2, d4n5yo1, d4n5yo2, d4n5yp1, d4n5yp2, d4n5yq1, d4n5yq2, d4n5yr1, d4n5yr2, d4n5ys1, d4n5ys2, d4n5yt1, d4n5yt2, d4n5yu1, d4n5yu2, d4n5yv1, d4n5yv2, d4n5yw1, d4n5yw2, d4n5yx1, d4n5yx2, d4n5yy1, d4n5yy2, d4n5yz1, d4n5yz2