PDB entry 4n5y

View 4n5y on RCSB PDB site
Description: Crystal structure of H5 hemagglutinin mutant (N158D, N224K and Q226L) from the influenza virus A/Viet Nam/1203/2004 (H5N1)
Class: Viral protein
Keywords: H5N1, Influenza Virus, hemagglutinin, Viral Protein, Ferret transmissible
Deposited on 2013-10-10, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: 0.215
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5ya1, d4n5ya2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yb1, d4n5yb2
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yc1, d4n5yc2
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yd1, d4n5yd2
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5ye1, d4n5ye2
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yf1, d4n5yf2
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yg1, d4n5yg2
  • Chain 'H':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yh1, d4n5yh2
  • Chain 'I':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yi1, d4n5yi2
  • Chain 'J':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yj1, d4n5yj2
  • Chain 'K':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yk1, d4n5yk2
  • Chain 'L':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yl1, d4n5yl2
  • Chain 'M':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5ym1, d4n5ym2
  • Chain 'N':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yn1, d4n5yn2
  • Chain 'O':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yo1, d4n5yo2
  • Chain 'P':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yp1, d4n5yp2
  • Chain 'Q':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yq1, d4n5yq2
  • Chain 'R':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yr1, d4n5yr2
  • Chain 'S':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5ys1, d4n5ys2
  • Chain 'T':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yt1, d4n5yt2
  • Chain 'U':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yu1, d4n5yu2
  • Chain 'V':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yv1, d4n5yv2
  • Chain 'W':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yw1, d4n5yw2
  • Chain 'X':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yx1, d4n5yx2
  • Chain 'Y':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d4n5yy1, d4n5yy2
  • Chain 'Z':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
    Domains in SCOPe 2.07: d4n5yz1, d4n5yz2
  • Chain 'a':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
  • Chain 'b':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
  • Chain 'c':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
      • engineered mutation (157)
      • engineered mutation (223)
      • engineered mutation (225)
  • Chain 'd':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-176)
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4n5yA (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yA (A:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4n5yB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4n5yC (C:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yC (C:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4n5yD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4n5yE (E:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yE (E:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4n5yF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4n5yG (G:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yG (G:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4n5yH (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yH (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4n5yI (I:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yI (I:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4n5yJ (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yJ (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4n5yK (K:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yK (K:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4n5yL (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yL (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4n5yM (M:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yM (M:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4n5yN (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yN (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4n5yO (O:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yO (O:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4n5yP (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yP (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4n5yQ (Q:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yQ (Q:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4n5yR (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yR (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4n5yS (S:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yS (S:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4n5yT (T:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yT (T:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4n5yU (U:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yU (U:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4n5yV (V:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yV (V:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4n5yW (W:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yW (W:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4n5yX (X:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yX (X:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4n5yY (Y:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yY (Y:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4n5yZ (Z:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4n5yZ (Z:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.