Lineage for d1yhab_ (1yha B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.7: Filamentous bacteriophage ssDNA-binding proteins [50315] (2 proteins) Protein Gene V protein [50316] (2 species) Species Filamentous bacteriophage (f1, M13) [50317] (19 PDB entries) 
Domain d1yhab_: 1yha B: [25385]
Details for d1yhab_
PDB Entry: 1yha (more details), 2.5 Å
PDB Description: crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
SCOP Domain Sequences for d1yhab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yhab_ b.40.4.7 (B:) Gene V protein {Filamentous bacteriophage (f1, M13)}
mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgnehpvlvkitldegqpayapgl
ytvhlssfkvgqfgslmidrlrlvpak
SCOP Domain Coordinates for d1yhab_:
Click to download the PDB-style file with coordinates for d1yhab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yhab_:
- d1yhab_ appears in SCOP 1.57
- d1yhab_ appears in the current release, SCOPe 2.08
View in 3D
