Lineage for d4mk5a1 (4mk5 A:1-195)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136662Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2136663Protein PA N-terminal domain [254375] (5 species)
  7. 2136664Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)
  8. 2136672Domain d4mk5a1: 4mk5 A:1-195 [253802]
    Other proteins in same PDB: d4mk5a2
    automated match to d3ebja_
    protein/RNA complex; complexed with 28a, edo, mn, so4

Details for d4mk5a1

PDB Entry: 4mk5 (more details), 1.9 Å

PDB Description: 6-(3-methoxyphenyl)pyridine-2,3-diol bound to influenza 2009 pH1N1 endonuclease
PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4mk5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mk5a1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqse

SCOPe Domain Coordinates for d4mk5a1:

Click to download the PDB-style file with coordinates for d4mk5a1.
(The format of our PDB-style files is described here.)

Timeline for d4mk5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mk5a2