SCOPe 2.04: Domain d4mk5a_: 4mk5 A:

Lineage for d4mk5a_ (4mk5 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (3 species)

7. Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)

8. Domain d4mk5a_: 4mk5 A: [253802]
   automated match to d3ebja_
   protein/RNA complex; complexed with 28a, edo, mn, so4

Details for d4mk5a_

PDB Entry: 4mk5, 1.9 Å

PDB Description: 6-(3-methoxyphenyl)pyridine-2,3-diol bound to influenza 2009 pH1N1 endonuclease

PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4mk5a_:

Sequence; same for both SEQRES and ATOM records:

>d4mk5a_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
gplgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfid
ergesiivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydyken
rfieigvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrl
ftirqemasrslwdsfrqse

Timeline for d4mk5a_:

• d4mk5a_ is new in SCOPe 2.04-stable
  
• d4mk5a_ appears in SCOPe 2.05
  
• d4mk5a_ appears in the current release, SCOPe 2.08, called d4mk5a1