Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
Protein automated matches [226913] (9 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries) |
Domain d4lo2b2: 4lo2 B:152-293 [253667] Other proteins in same PDB: d4lo2a3, d4lo2b3 automated match to d2e4ma2 |
PDB Entry: 4lo2 (more details), 2.25 Å
SCOPe Domain Sequences for d4lo2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lo2b2 b.42.2.0 (B:152-293) automated matches {Clostridium botulinum [TaxId: 1491]} nftckispildlnkvvqqvdvtnlnvnlytwdygrnqkwtiryneekaayqffntilsng vltwifsngntvrvsssndqnndaqywlinpvsdtdetytitnlrdttkaldlyggqtan gtaiqvfnyhgddnqkwnirnp
Timeline for d4lo2b2: