Lineage for d4lo2b2 (4lo2 B:152-293)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385272Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2385504Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2385505Protein automated matches [226913] (9 species)
    not a true protein
  7. 2385528Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)
  8. 2385536Domain d4lo2b2: 4lo2 B:152-293 [253667]
    Other proteins in same PDB: d4lo2a3, d4lo2b3
    automated match to d2e4ma2

Details for d4lo2b2

PDB Entry: 4lo2 (more details), 2.25 Å

PDB Description: HA17-HA33-Lac
PDB Compounds: (B:) ha-33

SCOPe Domain Sequences for d4lo2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lo2b2 b.42.2.0 (B:152-293) automated matches {Clostridium botulinum [TaxId: 1491]}
nftckispildlnkvvqqvdvtnlnvnlytwdygrnqkwtiryneekaayqffntilsng
vltwifsngntvrvsssndqnndaqywlinpvsdtdetytitnlrdttkaldlyggqtan
gtaiqvfnyhgddnqkwnirnp

SCOPe Domain Coordinates for d4lo2b2:

Click to download the PDB-style file with coordinates for d4lo2b2.
(The format of our PDB-style files is described here.)

Timeline for d4lo2b2: