Lineage for d1rl2b2 (1rl2 B:60-125)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 protein domains)
    barrel, closed; n=5, S=8
  6. 2383257Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2383258Species Bacillus stearothermophilus [TaxId:1422] [50300] (1 PDB entry)
  8. 2383260Domain d1rl2b2: 1rl2 B:60-125 [25343]
    Other proteins in same PDB: d1rl2a1, d1rl2b1

Details for d1rl2b2

PDB Entry: 1rl2 (more details), 2.3 Å

PDB Description: ribosomal protein l2 rna-binding domain from bacillus stearothermophilus
PDB Compounds: (B:) protein (ribosomal protein l2)

SCOPe Domain Sequences for d1rl2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl2b2 b.40.4.5 (B:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadiki

SCOPe Domain Coordinates for d1rl2b2:

Click to download the PDB-style file with coordinates for d1rl2b2.
(The format of our PDB-style files is described here.)

Timeline for d1rl2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rl2b1