Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
Species Bacillus stearothermophilus [TaxId:1422] [50300] (1 PDB entry) |
Domain d1rl2b2: 1rl2 B:60-125 [25343] Other proteins in same PDB: d1rl2a1, d1rl2b1 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1rl2 (more details), 2.3 Å
SCOPe Domain Sequences for d1rl2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl2b2 b.40.4.5 (B:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]} qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp dadiki
Timeline for d1rl2b2: