Lineage for d1rl2a1 (1rl2 A:126-195)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784107Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2784108Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2784109Species Bacillus stearothermophilus [TaxId:1422] [50116] (1 PDB entry)
  8. 2784110Domain d1rl2a1: 1rl2 A:126-195 [24610]
    Other proteins in same PDB: d1rl2a2, d1rl2b2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1rl2a1

PDB Entry: 1rl2 (more details), 2.3 Å

PDB Description: ribosomal protein l2 rna-binding domain from bacillus stearothermophilus
PDB Compounds: (A:) protein (ribosomal protein l2)

SCOPe Domain Sequences for d1rl2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl2a1 b.34.5.3 (A:126-195) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg
kcratvgevg

SCOPe Domain Coordinates for d1rl2a1:

Click to download the PDB-style file with coordinates for d1rl2a1.
(The format of our PDB-style files is described here.)

Timeline for d1rl2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rl2a2