![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
![]() | Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [50116] (1 PDB entry) |
![]() | Domain d1rl2b1: 1rl2 B:126-196 [24611] Other proteins in same PDB: d1rl2a2, d1rl2b2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1rl2 (more details), 2.3 Å
SCOPe Domain Sequences for d1rl2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl2b1 b.34.5.3 (B:126-196) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]} gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg kcratvgevgn
Timeline for d1rl2b1: