![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [50297] (2 PDB entries) |
![]() | Domain d1eifa2: 1eif A:74-133 [25340] Other proteins in same PDB: d1eifa1 |
PDB Entry: 1eif (more details), 1.9 Å
SCOPe Domain Sequences for d1eifa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eifa2 b.40.4.5 (A:74-133) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Methanococcus jannaschii [TaxId: 2190]} idrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyieavgqykitrvig
Timeline for d1eifa2: