Lineage for d1eifa2 (1eif A:74-133)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789682Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species)
  7. 2789685Species Methanococcus jannaschii [TaxId:2190] [50297] (2 PDB entries)
  8. 2789687Domain d1eifa2: 1eif A:74-133 [25340]
    Other proteins in same PDB: d1eifa1

Details for d1eifa2

PDB Entry: 1eif (more details), 1.9 Å

PDB Description: eukaryotic translation initiation factor 5a from methanococcus jannaschii
PDB Compounds: (A:) eukaryotic translation initiation factor 5a

SCOPe Domain Sequences for d1eifa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eifa2 b.40.4.5 (A:74-133) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Methanococcus jannaschii [TaxId: 2190]}
idrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyieavgqykitrvig

SCOPe Domain Coordinates for d1eifa2:

Click to download the PDB-style file with coordinates for d1eifa2.
(The format of our PDB-style files is described here.)

Timeline for d1eifa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eifa1