PDB entry 1eif

View 1eif on RCSB PDB site
Description: eukaryotic translation initiation factor 5a from methanococcus jannaschii
Class: initiation factor
Keywords: initiation factor, eif-5a, translation, ob-fold
Deposited on 1998-07-29, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 5a
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eifa1, d1eifa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eifA (A:)
    viimpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkhggakarvvgigifekvkke
    fvaptsskvevpiidrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyi
    eavgqykitrviggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eifA (A:)
    mpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkgakarvvgigifekvkkefvapt
    sskvevpiidrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyieavgq
    ykitrvig