Lineage for d1eifa1 (1eif A:4-73)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046659Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2046800Family b.34.5.2: eIF5a N-terminal domain-like [50110] (3 protein domains)
  6. 2046805Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species)
  7. 2046808Species Methanococcus jannaschii [TaxId:2190] [50112] (2 PDB entries)
  8. 2046810Domain d1eifa1: 1eif A:4-73 [24608]
    Other proteins in same PDB: d1eifa2

Details for d1eifa1

PDB Entry: 1eif (more details), 1.9 Å

PDB Description: eukaryotic translation initiation factor 5a from methanococcus jannaschii
PDB Compounds: (A:) eukaryotic translation initiation factor 5a

SCOPe Domain Sequences for d1eifa1:

Sequence, based on SEQRES records: (download)

>d1eifa1 b.34.5.2 (A:4-73) Eukaryotic initiation translation factor 5a (eIF5a) {Methanococcus jannaschii [TaxId: 2190]}
mpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkhggakarvvgigifekvkkefva
ptsskvevpi

Sequence, based on observed residues (ATOM records): (download)

>d1eifa1 b.34.5.2 (A:4-73) Eukaryotic initiation translation factor 5a (eIF5a) {Methanococcus jannaschii [TaxId: 2190]}
mpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkgakarvvgigifekvkkefvapt
sskvevpi

SCOPe Domain Coordinates for d1eifa1:

Click to download the PDB-style file with coordinates for d1eifa1.
(The format of our PDB-style files is described here.)

Timeline for d1eifa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eifa2