SCOP 1.63: Domain d2eifa2: 2eif A:74-132

Lineage for d2eifa2 (2eif A:74-132)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (3 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [50297] (2 PDB entries)

8. Domain d2eifa2: 2eif A:74-132 [25339]
   Other proteins in same PDB: d2eifa1

Details for d2eifa2

PDB Entry: 2eif, 1.8 Å

PDB Description: Eukaryotic translation initiation factor 5A from Methanococcus jannaschii

SCOP Domain Sequences for d2eifa2:

Sequence; same for both SEQRES and ATOM records:

>d2eifa2 b.40.4.5 (A:74-132) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Methanococcus jannaschii}
idrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyieavgqykitrvi

Timeline for d2eifa2:

• d2eifa2 first appeared (with stable ids) in SCOP 1.55
  
• d2eifa2 appears in SCOP 1.61
  
• d2eifa2 appears in SCOP 1.65
  
• d2eifa2 appears in the current release, SCOPe 2.08